3130058064 <02/22-rdf-syntax-ns#type> 3109661024 <07/owl#FunctionalProperty> 3086198628 "CC(=O)OC(CC(=O)[O-])C[N+](C)(C)C"@en 1045420899 459205244 301407449 "https://docs.google.com/document/d/1kBv1ep_9g3sTR-SD3jqzFqhuwo9TPNF-l-9fUDbO6rM/edit?pli=1"^^<2001/XMLSchema#anyURI> 298601098 :v:date:0000000000000002022-01-17T00:00:00 298339947 :v:date:0000000000000002005-03-27-05:00T00:00:00 283096731 258721422 258391322 258219743 258219733 222808309 151994244 62903268 60788483 49022864 24270702 18649792 "NCI Thesaurus OBO Edition" 15231213 :v:date:0000000000000001975-06-01-05:00T00:00:00 15131618 "A B Makar, K E McMartin, M Palese, T R Tephly; Biochemical medicine; 1975 Jun; 13(2):117-26" 13942376 <01/rdf-schema#label> 10575839 "CI_ChemClass" 6884438 5856067 "CHEBI:27560" 5662362 3776928 2815802 <07/owl#annotatedSource> 2560854 _:u_b0 <07/owl#annotatedTarget> 2560854 _:u_b0 "A geometric operator, specified in Egenhofer 1989. Two features meet if they share a junction on the sequence. X adjacent_to Y iff X and Y share a boundary but do not overlap." 2516071 "http://purl.obolibrary.org/obo/MI_0914"^^<2001/XMLSchema#anyURI> 2268864 "BFO:0000050" <07/owl#annotatedProperty> 2251503 _:u_b0 <01/rdf-schema#subClassOf> 1763804 1529804 1308001 "A1B" 1185674 "(+)-Atherospermoline" <07/owl#onProperty> 1014721 _:u_b0 <07/owl#someValuesFrom> 1013348 _:u_b0 <07/owl#sameAs> 749018 642193 _:u_b1 "PT" 642191 _:u_b1 "NCI" 595840 _:u_b1000 589407 572716 "A protein coding gene GBX2 in chicken." 551457 545706 "gene" 545698 "CGNC:10048" 538381 "medicarpin" 488082 <02/22-rdf-syntax-ns#first> 424522 _:u_b0 <02/22-rdf-syntax-ns#rest> 422505 _:u_b0 _:u_b1 407665 "alimentary tract and metabolism"@en 369555 344364 <01/rdf-schema#comment> 336872 "Absolute location as defined by the referenced sequence database record. E.g. an operon has a absolute region on the DNA molecule referenced by the UnificationXref." 280207 260282 232465 205576 6 205100 "A" 189677 _:u_b0 "KEGG COMPOUND" 188517 "NCI" 186494 182437 "Conceptual Entity" 172700 "A1" 172700 "Role_Has_Domain" 169585 "PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ" <07/owl#intersectionOf> 160876 _:u_b1000001 _:u_b1000002 <07/owl#equivalentClass> 158704 _:u_b21 150845 "C36H38N2O6" 150063 "0" 149269 "594.698" 149208 "594.27299" 147976 "COc1cc2CCN(C)[C@H]3Cc4ccc(Oc5cc(C[C@@H]6N(C)CCc7cc(OC)c(O)c(Oc1cc23)c67)ccc5O)cc4" 141757 138722 "InChI=1S/C36H38N2O6/c1-37-13-11-23-18-31(41-3)32-20-26(23)27(37)15-21-5-8-25(9-6-21)43-30-17-22(7-10-29(30)39)16-28-34-24(12-14-38(28)2)19-33(42-4)35(40)36(34)44-32/h5-10,17-20,27-28,39-40H,11-16H2,1-4H3/t27-,28-/m0/s1" 138722 "XGEAUXVPBXUBKN-NSOVKSMOSA-N" 116538 "FDA" 115361 "C1514768" 99734 "A1BG" 95435 79804 72440 "Recombinant_Amphiregulin" 72043 _:u_b100000 "QS-SGRQ Past 4 Weeks Version TEST" 55572 6 55163 "B01F2035/35" 52524 "A percutaneous coronary intervention is necessary for a myocardial infarction that presents with ST segment elevation and the subject does not have recurrent or persistent symptoms, symptoms of heart failure or ventricular arrhythmia. The presentation is past twelve hours since onset of symptoms." 51417 "CL433438" 46092 "C26" 46053 "3683" 46044 "Pharmaceutical Preparations" 46044 "N0000000001" 45183 "C0013227" 37104 <07/owl#deprecated> 36802 "true"^^<2001/XMLSchema#boolean> 36008 "ATROPINE SULFATE0.4MG1" 36008 34249 "protein residue" 33499 _:u_b1000000 "UNII" 31482 "EGFR Family Interactions" 31374 "Role Has Domain" 30764 "50.6^7^50.67" 30312 28532 "Active" 25831 24373 _:u_b1000133 "Has Synonym" 24373 _:u_b1000133 "PT" 24373 _:u_b1000133 "therapeutic_agents" 24373 _:u_b1000133 "GDC" 23167 23025 "Ingredient" 23025 "4022085" 22356 22306 "CHEBI:7456" 19638 "Interferon Gamma-1b" 19638 "abacavir" 19347 "2013-09-16T11:50:41Z" 19333 "bf" 18680 "7MGE0HPM2H" 18473 17512 "77538-19-3" 17466 16973 16152 "153310" 15516 "ATROPINE TAB" 15300 "PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ" 14448 "D002121" 14448 "Calcium Channel Blockers" 14381 "M0000006" 13706 13693 12655 "Malignant" 12481 "A clinical syndrome with acute abdominal pain that is severe, localized, and rapid onset. Acute abdomen may be caused by a variety of disorders, injuries, or diseases." 11866 "ATROPINE SULFATE 0.4MG TAB" 11663 "USAGE NOTE: A salt form of a drug consists of 2 parts, one acidic and one basic group that are readily disassociated in liquid phase. Salt forms are either salts of strong acids and basic drugs (e.g. Atropine Sulfate, Cetirizine Hydrochloride) or salts of strong bases and acidic drugs (Allopurinol Sodium). This association is usually used in conjunction with Has_Free_Acid_Or_Base_Form." 11487 11037 "acyl-CoA or acyl binding" 10837 "C15H22N6O5S" 9716 "0.4" 9715 "MG" 9158 _:u_b1002919 "from WHO" 9101 8425 "Obsolete_Concept" 7820 _:u_b1000916 "3.1" 7651 "725443" 7089 "725443" 7087 "725443" 6859 6414 6350 _:u_b1116716 "GO:0005125" 6350 _:u_b1116716 "NAS" 6350 _:u_b1116716 "CGAP" 6350 _:u_b1116716 "29-SEP-2003" 6267 "dopamine receptor activity" 6025 6009 5673 "U41743" 5574 "0" 5530 5507 5507 5507 "Significant" 5475 "196528" 5458 "Mathias Brochhausen"@en 5443 "HGNC:18037" 5442 "ThiL (Thiamine-monophosphate kinase) plays a dual role in de novo biosynthesis and in salvage of exogenous thiamine. Thiamine salvage occurs in two steps, with thiamine kinase catalyzing the formation of thiamine phosphate, and ThiL catalyzing the conversion of this intermediate to thiamine pyrophosphate. The N-terminal domain of ThiL binds ATP and is related to the ATP-binding domains of hydrogen expression/formation protein HypE, the AIR synthases, FGAM synthase and selenophosphate synthetase (SelD)." 5374 "Q05315" 5016 "software source code version control repository"@en 4868 "Coagulation_Study" 4536 "189822004" 4351 4254 "Oog3" 4187 4174 "Person:Alan Ruttenberg" 4048 3949 "https://github.com/geneontology/go-ontology/issues/23472"^^<2001/XMLSchema#anyURI> 3734 3633 "CHEBI:22565" 3024 "Chemicals_and_Drugs_Kind" <1.1/identifier> 2876 "protege#defaultLanguage" 2778 "Lamina-Associated_Polypeptide_2_Isoform_Alpha" 2515 "24I7KUI7MK" 2375 "616524" 2304 "GO:0042254" 2218 "45894" 2094 "Yes" 1970 "26S Proteasome-Associated UCH Interacting Protein 1" <01/rdf-schema#isDefinedBy> 1892 1854 1845 1693 "SPL Flavor (C-DRG-0934)" 1657 1583 "The NCIt OBO Edition project aims to increase integration of the NCIt with OBO Library ontologies. NCIt is a reference terminology that includes broad coverage of the cancer domain, including cancer related diseases, findings and abnormalities." 1542 "data set creation"@en 1451 "

The terminology subset that includes terms pertaining to the CDISC questionnaire terminology.

The terminology can be downloaded at this location: <"> CDISC Questionnaire Terminology.

" 1448 "Julius Caesar"@en <07/owl#onClass> 1273 _:u_b10403 1261 "MMM" 1231 "8384/3" <07/owl#qualifiedCardinality> 1228 _:u_b10403 1 1172 "No" 1142 "No" 1059 <01/rdf-schema#subPropertyOf> 1043 <07/owl#disjointWith> 960 901 "physical dimensional quantity"@en <0.1/homepage> 882 796 781 "12927386" 754 "Myelodysplastic syndrome; multiple myeloma; chronic myeloid leukemia; acute myelocytic leukemia" 673 667 "Gene_Involved_In_Pathogenesis_Of_Disease some 'Acute Myeloid Leukemia with inv(3) (q21.3;q26.2) or t(3;3) (q21.3;q26.2); GATA2, MECOM'" 663 <07/owl#unionOf> 639 _:u_b0 _:u_b1 635 632 619 611 <01/rdf-schema#range> 598 560 547 544 541 "BFO 2 Reference: In all areas of empirical inquiry we encounter general terms of two sorts. First are general terms which refer to universals or types:animaltuberculosissurgical procedurediseaseSecond, are general terms used to refer to groups of entities which instantiate a given universal but do not correspond to the extension of any subuniversal of that universal because there is nothing intrinsic to the entities in question by virtue of which they – and only they – are counted as belonging to the given group. Examples are: animal purchased by the Emperortuberculosis diagnosed on a Wednesdaysurgical procedure performed on a patient from Stockholmperson identified as candidate for clinical trial #2056-555person who is signatory of Form 656-PPVpainting by Leonardo da VinciSuch terms, which represent what are called ‘specializations’ in [81"@en 536 525 "antibody" 519 494 "A8|C101516" 485 "AD000" 462 "VEuPathDB"@en <01/rdf-schema#domain> 444 _:u_b0 440 431 431 "time derived unit" 393 "17864" 385 382 "rs429358" 381 358 _:u_b0 347 "Really of interest to developers only"@en 345 341 "Severed Digit(s), (finger or toe)" 335 "h_ace2Pathway" 332 "mcg" 329 320 <07/owl#oneOf> 296 _:u_b0 _:u_b1 251 "A8|C100130" 237 "map01100" <07/owl#inverseOf> 236 <07/owl#allValuesFrom> 226 _:u_b0 _:u_b1 207 "MI0000783" 203 "CARTB" 202 "CSF1R/PDGFR Family" 201 182 180 "31026031" 154 "MGI:2159769" <1.1/description> 154 "The Gene Ontology (GO) provides a framework and set of concepts for describing the functions of gene products from all organisms." <07/owl#propertyChainAxiom> 149 _:u_b0 <01/rdf-schema#seeAlso> 148 "http://www.obofoundry.org/ro/#OBO_REL:part_of" 135 134 "321" 124 <07/owl#hasValue> 111 _:u_b101 105 99 "free to use,share,modify. modify with attribution [http://creativecommons.org/licenses/by/4.0/]." 97 97 91 "part_of" <1.1/creator> 85 "Alan Ruttenberg"@en 81 "core" <1.1/contributor> 80 "Alan Ruttenberg" 70 "solubility (to dissolve when put in fluid); fragility (disposition to break when dropped)"@en <11/swrl#argument1> 69 _:u_b473 <1.1/source> 62 "http://www.obofoundry.org/ro/#OBO_REL:preceded_by" <11/swrl#argument2> 58 _:u_b473 <11/swrl#propertyPredicate> 58 _:u_b473 55 "Y" 52 "(forall (x y) (if (and (Continuant x) (exists (t) (continuantPartOfAt y x t))) (Continuant y))) // axiom label in BFO2 CLIF: [009-002] " 51 "OBO_REL:located_in" 50 "INN" 47 43 "Y" 42 39 "A planned process resulting in a software product involving the creation of source code."@en 39 "Assembly Algorithm" 39 _:u_b16 <1.1/date> 38 :v:date:0000000000000002018-05-11T16:35:11 <07/owl#minQualifiedCardinality> 37 _:u_b154 2 36 "entity" 35 "Entity" 32 "Y" 32 "An alternative lexical label for a resource."@en <0.1/depicted_by> 32 <30/Urinary_system.svg> 31 "NOTE: Includes nicotine polacrilex and other deterrents (AD900). Excludes anticoagulant antagonists (BL200,VT700); antifolate antagonists (VT102); antivenins (IM300); dialysis solutions (IR200); emetics (GA600); opioid antagonists (CN102)." 28 27 "Y" <1.1/license> 27 25 "cell and encapsulating structures" <07/owl#cardinality> 25 _:u_b10 1 23 "Y" 23 <07/owl#complementOf> 23 _:u_b121 _:u_b122 <07/owl#members> 23 _:u_b1003 _:u_b1004 22 "if b is a continuant and if, for some t, c has_continuant_part b at t, then c is a continuant. (axiom label in BFO2 Reference: [126-001])"@en 22 "Austin Meier" 22 "false"^^<2001/XMLSchema#boolean> <07/owl#imports> 21 20 " some (\n and some ?Y)" <11/swrl#body> 19 _:u_b471 _:u_b472 <11/swrl#head> 19 _:u_b471 _:u_b478 18 :v:date:0000000000000002021-10-13T20:29:36 16 <07/owl#minCardinality> 15 _:u_b12950 2 13 "true"^^<2001/XMLSchema#boolean> 12 "study" 12 "cjm" 12 " http://dx.doi.org/10.1021/ci980137x" 11 11 "NCT03901690" 11 <07/owl#maxQualifiedCardinality> 11 _:u_b225399 2 <07/owl#versionIRI> 11 <2019-08-26/bfo.owl> <11/swrl#classPredicate> 11 _:u_b475 11 "By convention, skos:broader is only used to assert an immediate (i.e. direct) hierarchical link between two conceptual resources."@en 11 "volt-second" 10 10 10 "false"^^<2001/XMLSchema#boolean> 9 <07/owl#versionInfo> 9 "NDF-RT2 [Public Edition]" 8 "general class inclusion axioms:\n'is part of' some 'physical entity' subClassOf 'is located in' some 'physical entity'\n\nrole chains:\n'has capability' o 'is realized in' -> 'is participant in'" 7 "Defined" 7 7 6 "http://ccm.ucdavis.edu/cfsidserver/view.cfm?cat=Mouse_N_Prostate&img=MP19.sid&rgn=&nlvl=5&iwid=26150&ihei=27998" 6 "Y" 6 5 _:u_b103 "true"^^<2001/XMLSchema#boolean> 4 "en" <1.1/title> 4 "Gene Ontology" 4 "chebi_ontology" 4 "1.2" <07/owl#distinctMembers> 4 _:u_b21549 _:u_b21550 <07/owl#equivalentProperty> 4 _:u_b8 <07/owl#onDatatype> 4 _:u_b376 <2001/XMLSchema#double> <07/owl#withRestrictions> 4 _:u_b376 _:u_b377 3 "true"^^<2001/XMLSchema#boolean> 3 "Class: ?X DisjointWith: RO_0002162 some ?Y " 3 "(forall (?x ?y) \n (iff \n (fasciculates_with ?x ?y)\n (exists (?nps ?npbs)\n (and \n ("neuron ; CL_0000540" ?x)\n ("neuron projection bundle ; CARO_0001001" ?y) \n ("neuron projection segment ; CARO_0001502" ?nps)\n ("neuron projection bundle segment ; CARO_0001500' " ?npbs)\n (part_of ?npbs ?y) \n (part_of ?nps ?x)\n (part_of ?nps ?npbs)\n (forall (?npbss)\n (if\n (and \n ("neuron projection bundle subsegment ; CARO_0001501" ?npbss)\n (part_of ?npbss ?npbs) \n )\n (overlaps ?nps ?npbss)\n ))))))" 3 "2.16.840.1.113883.3.26.1.1.2" 3 "PREFIX rdfs: <01/rdf-schema#>\nPREFIX owl: <07/owl#>\nPREFIX in_taxon: \nPREFIX never_in_taxon: \nCONSTRUCT {\n in_taxon: a owl:ObjectProperty .\n ?x owl:disjointWith [\n a owl:Restriction ;\n owl:onProperty in_taxon: ;\n owl:someValuesFrom ?taxon\n ] .\n ?x rdfs:subClassOf [\n a owl:Restriction ;\n owl:onProperty in_taxon: ;\n owl:someValuesFrom [\n a owl:Class ;\n owl:complementOf ?taxon\n ]\n ] .\n}\nWHERE {\n ?x never_in_taxon: ?taxon .\n}" 3 _:u_b187 "true"^^<2001/XMLSchema#boolean> 3 3 "http://purl.obolibrary.org/obo/OBI_0000049"^^<2001/XMLSchema#anyURI> 3 "09:06:2022 14:24" 3 "chebi" <07/owl#hasSelf> 3 _:u_b457 "true"^^<2001/XMLSchema#boolean> <07/owl#maxCardinality> 3 _:u_b12926 1 <07/owl#onDataRange> 3 _:u_b113 <2001/XMLSchema#float> <07/owl#propertyDisjointWith> 3 2 2 "Spondylitis" 2 _:u_b1118162 "Hahn-Dantona, Elizabeth" 2 _:u_b1118162 "2018-11-07" 2 <1.1/format> 2 "OWL-DL"@en <3.3/swrla.owl#isRuleEnabled> 2 _:u_b480 "true"^^<2001/XMLSchema#boolean> 2 "PRO dB" <2001/XMLSchema#maxInclusive> 2 _:u_b380 1 <2001/XMLSchema#minInclusive> 2 _:u_b378 0 1 1 "0" 1 1 "If we have the annotation P is-direct-form-of Q, and we have inverses P' and Q', then it follows that P' is-direct-form-of Q'" 1 1 <1.1/language> 1 "en" <1.1/rights> 1 "http://creativecommons.org/licenses/by/3.0" <1.1/subject> 1 "An ontology for the annotation of biomedical and functional genomics experiments."@en 1 1 :v:date:0000000000000002010-03-29T00:00:00 1 1 "sio"@en 1 "http://semanticscience.org/resource/" 1 "GO:0040011" 1 "fusibility" 1 "true"^^<2001/XMLSchema#boolean> 1 "true"^^<2001/XMLSchema#boolean> <2001/XMLSchema#maxExclusive> 1 _:u_b547 0 <2001/XMLSchema#minExclusive> 1 _:u_b539 0 <0.1/mbox> 1 <0.1/page> 1